Sitemap A clean, hierarchical map of this site. Machine-readable XML lives at /sitemap.xml. Home Blog 2026 A Solar System Kids Can Click Sep 9 The War You Don't Notice You're Losing Sep 2 When Cleo looks for me Aug 29 Life Is Electric Aug 29 The Agent That Remembers Why Aug 29 The Wheel of Government Aug 29 A timeline of world history Aug 28 The Shape of an Argument Aug 28 The Machine at the Bottom of the Sea Aug 20 How America Can Carry $40 Trillion of Debt Aug 20 The Price of a Thought Aug 20 Styling Markdown with Kramdown Attributes Aug 17 It's Always Sunny In Philadelphia, Season 8 Ep. 10: Mac Evolution Highlight, FXX - YouTube Aug 17 NearbyWiki Aug 17 Making Software Aug 17 Making Management Smaller Aug 17 The Camp Above Hong Kong Aug 16 Working Copy Users’ guide Aug 16 Building Prometheus Aug 15 Harry Potter Is a Story About Virtue, Not Magic Aug 15 When Intelligence Becomes Cheap Aug 15 A Computer with a Signature Aug 14 The Paradox of Cyber Aug 14 The Best Startup Directory Is a Time Machine Aug 14 xai-org/x-algorithm: Algorithm powering the For You feed on X Aug 13 Ordinary Abundance Aug 13 Your brain doesn't see reality — it tries to predict it - Big Think Aug 13 Do It 14,000 Times Slower With This One Trick – Semi-Rad.com Aug 13 Project Gutenberg Aug 13 RSS Aug 13 GitHub Copilot app Aug 13 vas on X Aug 13 Pope: Like a stream leading to its source, music leads us to God - Vatican News Aug 13 The Gervais Principle, Or The Office According to The Office — Ribbonfarm Aug 13 How to Tell AI Writing from AI Slop When AI Writing Is Getting Hard to Spot Aug 12 You Don't Learn AI. You Learn a New Way of Working. Aug 12 The AI Employee Needs a Computer Aug 12 The Fire-Bearer at Starbase Aug 11 Why Chesterton's Lepanto Still Matters Aug 11 The Man Who Read the Internet for Me Aug 11 The Great Un-Learning: Why Forgetting Old Skills Matters as Much as Acquiring New Ones Aug 9 Designing an Editorial Page for Robot Vacuums Aug 8 When Will the First American Pope Come Home? Aug 6 The Unsung Workhorse of the Open Web: Inside jsDelivr Aug 6 The Rhyme of the Machine Aug 6 The Blog That Is a Single File Aug 6 The Accidental Wallpaper of the Modern Web Aug 6 Embed examples Aug 5 When Canadian Wildfires Reach Florida: The Hidden Impact on Tourism Aug 5 SpaceX’s First Earnings Report: A High-Stakes Test of Belief Aug 5 How I built jonathanfrei.com V5 Aug 5 Easy URL embeds in Markdown Aug 5 Building V5 with an AI coding partner Aug 5 The Fire Next Time: Why Our Forest Policy Is Just Arson Aug 4 Hello, V5 Aug 4 Example Domain Jul 1 2016 Mad Thomas: Fury Tracks Nov 8 A History of Japan by Bill Wurtz Feb 8 Turning four Feb 4 Calvin and Hobbes Awaken Jan 10 This is how I weekend Jan 6 Traveling through the Star Wars films Jan 5 Demographic rules Jan 5 There's barely any damage done now Jan 4 Alien optimism Jan 4 Fifteen things I'm thankful for in 2015 Jan 2 2015 Star Wars up close Sep 17 Stock market-sized countries Sep 15 Simon Koay's Superbet Sep 14 Pluto Sep 11 Bottle shot Sep 11 Web design is easy when every site looks the same Sep 10 #TBT: Natalie's Baptism Sep 10 The home stretch Sep 9 Baby name explorer Sep 4 This makes me laugh so hard Sep 3 Ancient Egypt's Fury Road Sep 1 Selfie sticks stick Aug 31 One billion people Aug 28 Real life first-person video game Aug 24 Cyborg Enhancements: Wheels and Pedals Aug 23 Making up numbers as needed Aug 23 Sail Week In Amsterdam Aug 22 Rocking Tauntaun Aug 21 Emoji Mosaic Aug 20 Wine causes and prevents cancer Aug 20 Timelapse of Earth from the ISS Aug 18 Chess Academy For iOS Aug 8 National Geographic photo contest winners Aug 7 NASA captures photos of the Moon passing in front of the Earth Aug 7 Happy Birthday Baby Girl! Jul 29 Caffeine Jul 21 46 recording mash-up of Stravinsky's "Rite of Spring" Apr 24 Get me my lightsaber Apr 17 There are few popular movies from the past 15 years I have not seen Apr 14 Five years of a non-conformist commute Apr 11 Who Who Mar 25 Interplanetary tourism Mar 24 A year of steps Mar 4 The world needs a House of Cards / 24 crossover Mar 3 Albums in the age of the algorithmic playlist Mar 2 Well, there goes my weekend Feb 27 The evolution of Batman on the big screen Feb 17 Turning three Feb 3 Simpsons intro in pixel art animation Feb 3 Nobody lives there Jan 23 Maternal stress relief Jan 22 Mixed messages Jan 19 Through You (Too) is my jam Jan 7 The Pillars of Creation Jan 7 Augmented hands Jan 7 Climbing to new heights Jan 4 Bat-Santa Jan 3 Bed time protestations Jan 3 The world is becoming a better place Jan 2 Fourteen things I'm thankful for from 2014 Jan 1 2014 Deep Dark Fears Dec 31 The tool you have Dec 31 Parable of the Polygons Dec 11 How speakers work Dec 10 Using kids as exercise equipment Dec 9 Population.io Dec 8 Wall art Dec 7 8-bit hell Dec 6 2014 year end news photos Dec 6 Concept art for Star Wars: The Force Awakens Dec 1 Jurassic World is open Nov 26 Wedding attire Nov 22 5733 Nov 20 "Out of the corner of your eye, you spot him...Shia LaBeauf...He's following you." Nov 19 The United States of Thanksgiving Nov 19 Car shaped bike rack Nov 16 Three giraffes at the lunch counter Nov 15 The boys waiting their turn Nov 15 Clouds arranged in a nearly perfect grid Nov 15 Joining the IndieWeb Nov 14 Museum of selfies Nov 14 Creative routines Nov 13 Photos of photos Nov 13 Trailer for the new Monument Valley levels Nov 13 First drafts of Wikipedia entries Nov 12 How it feels to walk in the city Nov 12 IndieWeb online Nov 11 Happy Veteran's Day Nov 11 Launchnik Nov 11 Web standards for the future Nov 11 Earth and Moon Nov 10 Weekend visit to the Naples Zoo Nov 10 XOXO 2014 videos Nov 9 Too Many Cooks Nov 8 AI is coming Nov 8 Emergency compliment Nov 7 My baby girl's laugh Nov 7 New Monument Valley levels Nov 7 See the music Nov 7 EFF secure messaging score card Nov 7 Kid toss Nov 4 Muhammad Ali in pictures Nov 4 Aurora over Norway Nov 3 You snuck your way right into my heart Nov 2 Daylight savings time Nov 2 Me and my girl Nov 1 Kids think I'm rich Oct 31 5719 Oct 31 Gandhi's letter to Hitler - 1939 Oct 30 Busy Vader Oct 30 Gabi's Yoga Challenge Oct 28 Test flight Oct 27 Napping in her swing Oct 27 Illustrations of my family Oct 25 Twitter is down Oct 24 Competing views of the future: Huxley vs. Orwell Oct 24 Star ship size comparison chart Oct 24 Living with a lion Oct 23 31 Years Oct 22 Napping snake Oct 22 A blast from the past Oct 20 Introducing Carrot Oct 20 3969 Oct 18 Appleoctopus Oct 18 After last year's government shutdown Oct 18 20th anniversary of the blog Oct 17 The personal site Oct 17 Boy in a box Oct 16 Skottie Young's Star Wars Covers Oct 16 16 October, 2014 07:26 Oct 16 I'm learning a lot from the fine folks involved wi... Oct 15 Ball Oct 15 dancedancedance Oct 15 Police Clash with protesters in Hong Kong Oct 15 Building a minimum viable product Oct 15 I made a playground Oct 15 "You are life" Oct 15 Pushing buttons to turn on lights Oct 12 At the farm Oct 12 Learning to play chess Oct 12 This girl is too cute Oct 12 My wife, the acrobat Oct 12 The boys relaxing Oct 12 3345 Oct 12 3332 Oct 12 The DigitalOcean difference Oct 11 3318 Oct 11 3317 Oct 11 3304 Oct 11 3294 Oct 11 3279 Oct 11 3277 Oct 11 3259 Oct 11 3257 Oct 11 3252 Oct 11 3248 Oct 11 3243 Oct 11 Auto-complete Oct 10 Yoga Joes Oct 10 Glass floor on the Eiffel tower Oct 8 Color explosion Oct 8 Comic Book Heaven Oct 8 New site Oct 8 Common misconceptions--visualized Oct 6 This site turned 5 over the weekend. Oct 6 I’m not sure if this should be categorized as a pro-tip or a life-hack.… Oct 5 Florida Fall has begun. Sitting outside, the wife said, “I need a blanket.”… Oct 5 Age verification exploit Oct 4 @MikeIsaac Now all the brands are going to want to get a dog to increase… Oct 3 Terms of Service; Didn't Read Oct 3 Halloween Oct 2 Homemade Halloween Oct 2 Are the rumors true? Oct 2 nosense Oct 1 2014 National Geographic photo contest Oct 1 Hamster wheel standing desk Oct 1 How’s this look? Oct 1 Hong Kong protests from above Oct 1 Jeff Goldblum is going to sell a lot of light bulbs. Oct 1 Photo Sep 28, 12 57 15 PM Sep 28 really Sep 26 donotbeupset Sep 26 Global cities Sep 26 Fall is in the air Sep 24 John Malcovich in famous photos http://j.mp/Y6lhv9 – [@jonathanfrei](… Sep 24 John Malcovich stars in famous photos Sep 24 sharkattack Sep 22 Caught looking Sep 21 This gif will come in handy for a future embarrassing screwup. Sep 21 This cheat sheet by Corey Smith can help you discover which social network… Sep 21 The BFFs, Batman and Superman, save the world again. (Illustration by Darwin… Sep 21 Light Pen Sep 20 You always have email. Sep 14 iDevice size spectrum, with Pop-Tart for reference. Sep 12 It is not entierly clear what problem the Apple Watch is meant to solve, but… Sep 11 Watchmen and Frozen Sep 7 Common misconceptions Sep 5 This supercut, by Jaume R. Lloret , highlights clips from a number of Wes… Sep 5 Mesmerizing jello bounce Sep 4 2014: A Facebook Odyssey. Sep 3 Untitled 96541805343 Sep 3 Gallup finds shifting views on morality Sep 3 Women Listening To Men In Art History Sep 2 This is a picture of my dad (on the right) receiving the UW Parkside Alumni… Sep 2 Technohyperbole Aug 29 Humans Need Not Apply. via Kottke . Aug 15 Relaxing in the afternoon Jul 15 45 years ago, men walked on the moon Jul 15 Of course it's a trick question Jul 1 My backyard (almost) Jun 19 Disneyland’s original prospectus : Boing Boing has an in-depth look at the… Jun 7 Clickbait grammar Jun 6 Collar stays. Jun 5 Detroit's Urban Decay May 30 Peak fat May 30 Marketers that figure out the LTV of their customers before their… May 22 Looks like Jagger May 2 dailyoverview : Easter Sunday St. Peter’s Basilica Vatican City 41°54′8″N… May 2 Waiting 'till the last minute Apr 2 My wife took this photo of my two youngest kids playing on our new back porch. Mar 21 It's all sports Mar 21 I'm moving to a new house Mar 13 Quiet please Mar 12 Ghost ships Mar 11 Cats with jetpacks Mar 10 A first Android first Mar 9 The web of relationship advice Mar 8 Becoming Geek Mar 7 Embedding Getty Mar 6 The clarity of experience Feb 5 Turning two Feb 1 One sided football Jan 31 Meet your new robot overlords Jan 29 Catching up on Football Jan 29 Steve's advice for graduates Jan 24 Enjoy each moment any way you like Jan 9 2013 Filmography 2013 Dec 27 The Copenhagen Wheel Dec 23 What to Read Next : InstaRank - v1.0 Dec 13 The world is getting older... Dec 11 Don't forget the open web Dec 11 Finding the right race Dec 9 Howidodance Gif 500 368 Http Bukk It Howidodance Gif Dec 9 Untitled 69364350932 Dec 8 Re-writing history (for the clicks) Dec 7 Never apologize for selfies. Dec 6 Santa Tracker Dec 6 Business card mockup Dec 6 Polyphasic sleep mask Dec 6 Why I bike to work Dec 6 The Pixar Theory Timeline Dec 6 Asana · Apps & Integrations Dec 6 School project Dec 6 cyanidedaze : Hawkeyes by Martin Simmonds Kate, Clint, and Lucky (AKA Pizza Dog) Dec 6 The Rise of Twitter Bots Dec 6 Delete guilt tasks Nov 21 Systems > Goals Nov 19 Pencil by FiftyThree Nov 19 The @GSElevator gift guide Nov 18 ‘This one runs on fat & saves you money’ by Peter Drew of Adelaide (photo by… Nov 15 Slob vs. Sharp (by Jim Benton ) Nov 13 Comments suck Nov 12 Education has an expiration date Oct 5 Knowing it’s coming doesn’t make this scene any less shocking. Oct 5 Pictures I've recently emailed to my wife Oct 4 This blog is four Oct 4 How America's Marriage Crisis Makes Income Inequality So Much Worse Oct 2 How Would We Report on the Government Shutdown if It Were Happening in… Oct 2 4 Rules to Make Star Wars Great Again (by Sincerely Truman ) Oct 2 Non-Chemical Warfare: Violence Continues in Syria Sep 20 Information entropy Sep 20 Anatomy of a bicycle - anthonyoram Sep 14 IBM Smarter Enterprise - U.S. Open Case Study - United States Sep 13 The Tale of the Three Brothers Sep 8 Half the US population lives in 146 counties Sep 6 How to disappear (from the web) Sep 5 Inbox Whack-a-Mole Sep 3 Nice try, Facebook Sep 1 Glow bike Aug 30 New Flickr app Aug 29 Practical typography Aug 28 I forgot my phone Aug 27 ARod promotes muscle enhancing substance to kids. Aug 12 A living room view. Aug 9 Every Second on the Internet Aug 9 Well, I wasn’t planning on sleeping tonight anyway. (via Sunset Reflected in… Aug 1 Hats. Jul 26 Looking everywhere. (via Luke Pearson - Illustration Nation ) Jul 26 Frog holding an umbrella. Photo by Penkdix Palme – National Geographic Your Shot Jul 26 Ninja Remote - Stealth TV Gadget Jul 22 In Chicago, 3-D Printers Are Available To Anyone With A Library Card Jul 17 The World Without Mobile (by QUALCOMMVlog ) Jul 17 New Google Play Store design Jul 16 NASA Hubble Finds a True Blue Planet (by NASA Goddard Photo and Video ) Jul 12 Motorcyclist Saves Cup of Coffee Jul 9 Look into my eyes Jun 4 Feedly will support third party RSS readers Jun 4 Harley Davidson National Rally in China May 15 Life's a Happy Song May 12 I’ve made a huge mistake May 9 BrandColors May 8 A Boy And His Atom May 1 Efficiency Apr 29 Fan made Star Wars posters Apr 29 Coffee Owls Apr 29 Horrible places to work Apr 26 Reason my son is crying: It’s a girl Apr 13 James Nares: “STREET” (2012) Apr 12 Calvin and Hobbes: 26 Years Later Apr 11 All human knowledge… Apr 6 Peter Drucker via GTD Times Apr 5 How Far is it to Mars? Apr 4 Analog social networks Apr 4 These animals are looking fine. via ZOO PORTRAITS . Apr 1 Swissmiss - How To Be Happy In Business Apr 1 Sunrise at the North Pole With the Moon at its Closest Point. via Twitter /… Apr 1 Musical Chairs (Choosing the Right Seat) by Alex Cornell Apr 1 Lent is over. Easter is here. That means it’s Coffee Time !!! Mar 31 mrgan : “Work” icon I don’t even recognize the first two icons. Mar 30 “What Our Saviour Saw from the Cross” Mar 29 This is how working with new CSS elements feels. Mar 28 I have an awesome wife Mar 28 Announcing Forecast Mar 26 Paris is the Paris of things that other things are the thing of. — Dan… Mar 26 Fine Art Mar 26 Google Glass throughout history Mar 26 Tip anyway Mar 25 Goodbye FeedBurner Mar 25 The Opposite of a Honeymoon Mar 23 Calvin and Hobbes Mar 20 Ryan Block : This is by far the best bit of user interface design I have… Mar 20 Frank Chimero Mar 20 John Siracusa Mar 20 Jason Fried Mar 20 Pope Francis - “Thrift Shop” Macklemore Mar 19 Google Reader, I will miss you Mar 15 Pope Francis Mar 15 Outnumbered Mar 12 The falling man Mar 6 Chicago Past Mar 6 R-Rated Pixar Mar 6 Let's make everyone above average Mar 6 Hypnotic motion Mar 5 Coffitivity Mar 5 An astronaut’s advice Mar 4 This is not a fair fight Mar 1 Promoting old books with new movies Mar 1 On a happy note Mar 1 How Search Works - The Story - “ Behind your simple page of results is a… Mar 1 Look…I’m a bat. Mar 1 Beijing air pollution : Feb 28 Is there a pope? Feb 28 How big is the moon? Feb 27 rough-and-tumblr : babbling brook. Feb 27 Language communities of Twitter (European detail) (by Eric Fischer ) Feb 26 You had one job Feb 16 John Siracusa - Hypercritical: Don’t Stop Thinking About Tomorrow Feb 15 A flash of lighting is seen over St. Peter’s Basilica during a rainstorm at… Feb 15 50 Years Ago: The World in 1963 Feb 15 When you pass on valentine’s messages to your loved one’s this year, don’t… Feb 14 My name is difficult to pronounce ( apparently ). And Merlin Mann thinks I… Feb 14 This Is What the Sky Could Look Like Over New York - NYTimes.com Feb 14 Ash Wednesday Feb 13 Accurate Feb 13 Northeast Slammed by Blizzard Feb 12 The Postal Service - A Tattered Line of String [OFFICIAL TRACK] (not the… Feb 12 Hand-painted Batman mug: courtesy of my wife. For my birthday. Feb 8 The Link Between Kids Who Walk or Bike to School and Concentration Feb 6 It’s my boat Feb 5 How to make wine Feb 4 Adam Green: The Spectacular Thefts of Apollo Robbins, Pickpocket Feb 2 Seeing Art Feb 2 Coffee: It Gets Me Through the Day - Imgur Jan 31 A short history of the death of culture Jan 31 China’s toxic sky makes for a whole industry of clever protective masks. Jan 30 Bonds, James Bonds Jan 30 Feeding swans and ducks Jan 30 littlepawz : What a wonderful idea: Pittsburgh Children’s Hospital brightens… Jan 30 Ideology, Not Competence Jan 30 [](http://travisjeffery.com/images/posts/cookie-monster-bored.gif ) Jan 30 I’ve been enjoying this with the boy. Jan 29 merlin : Mandy Moore - “When Will My Life Begin?” ( Tangled , 2010) I… Jan 29 Twitter / Cmdr_Hadfield: Weightless water Jan 29 Fred Wilson A VC: Just Do It Jan 29 The Wolf Man Jan 29 Gabi (She knew I had just watched Patrick Stewart’s Macbeth .) Jan 29 Rules Jan 29 List of Batman comics - Wikipedia Jan 29 Should this be my new bike? (via CrossRip Elite - Trek Bicycle ) Jan 29 Kickstarter is a thing. A big successful thing. Jan 29 (via Pearls Before Swine Comic Strip, January 13, 2013 on GoComics.com ) Jan 29 Wolfram-Alpha Personal Analytics Jan 29 Fugue state Jan 29 Editing Jan 29 Better Than Human: Why Robots Will — And Must — Take Our Jobs Jan 29 2012 Top 10 Posts on My Blog (by Page Views) of 2012 Dec 31 tastysynapse : Minimalistic Superhero Posters by * thelincdesign Dec 28 Afternoon walk Dec 21 Such an improvement! Dec 21 Be discerning. Dec 21 Good bye Dec 20 The Broad Axe Grill Dec 20 Tumblr for iPhone/iPad Dec 20 The 50 Best Animal Photos Of 2012 Dec 7 I'm really glad this conversation happened Dec 7 InFocus: 2012 Pictures of the Year Dec 7 Black marble Dec 7 Turkeys in Hot Pursuit Dec 5 Seth Godin - “A fire in South Buffalo!” Nov 26 Modern Medicine Nov 21 The Orange and the Egg Nov 21 Bear! Nov 21 Attention is the most valuable and limited resource Nov 21 Post 1,000 Nov 20 The Coffees : Nov 20 It might be time to add Taipei to the list of vacation destinations. Super… Nov 20 The Scream by Edvard Munch Nov 20 11 Ways to be Unremarkably Average Nov 20 Soon Nov 19 Renaud Garcia-Fons: Tiny Desk Concert : NPR Nov 19 Hypothetical Battles: If every state of the USA declared war against each… Nov 19 The one rule of coffee drinking Nov 19 The Anti-Todo List Nov 19 Kaboom Nov 16 Passing of an eclipse Nov 13 Do. Nov 7 I love this Nov 7 Nooooooooooooo Nov 5 Our solar system in action Oct 19 (via Apartment - mlkshk ) Oct 15 Hotel Sidi Driss Oct 14 Sad. Oct 14 Our education system Oct 14 Bob looks in the mirror Oct 14 Typographical Chess Set Oct 14 This is not my kid Oct 13 Beach reading Oct 13 Man on fire Oct 13 I think I’ll pass on this adventure Oct 13 Reach Oct 13 Still a lady Oct 12 How photographers take pictures of rock climbers Oct 12 Under water photos or Baroque paintings? Oct 12 Action Scene Cut Out Art Oct 12 Mid-life crisis Oct 12 Brainstorms Oct 11 Well, that escalated quickly. Oct 11 I’m so appy Oct 11 Girl on Fire Oct 11 Cynical Tea Bags Oct 11 Ninja rider Oct 10 Useful and believable promises Oct 10 Close Oct 10 The best interface is no interface Oct 10 Now, screens are changing not just in size, but also in pixel density.… Oct 10 How do tech companies make money? Oct 10 1850s poster of the planets Oct 10 Siri, Take This Down: Will Voice Control Shape Our Writing? Oct 10 James Taranto – ‘One Too Many’ - WSJ.com Oct 10 Achieve this Oct 9 Fall meets winter Oct 6 A dance with the departed Oct 5 The knight can visit each square on a chess board exactly once. - Imgur As… Oct 5 Soon. Soon. Soon, I hope. Oct 4 Frame by Frame Oct 4 I didn’t know peacocks could fly Oct 4 Distance to the horizon Oct 4 Winter is Coming Oct 3 Ferry Disaster in Hong Kong Oct 3 Yum. Oct 3 If only Hamlet had friends like these Oct 1 US population distribution by latitude and longitude. Via Visual.ly Oct 1 Van Gogh’s Starry Night Reproduced Using Hubble Telescope Images Oct 1 Know your States Sep 28 Happy Birthday to Gabi Sep 26 Yum, Batman Sep 24 Build a better mouse trap Sep 24 Gelatin cubes dropped onto solid reflective surface Sep 19 56 Years of Tornado Tracks Sep 19 Daring Fireball: The iPhone 5 Sep 19 Alicia Martín - Biografías, 2012 (by de_buurman ) Sep 19 Feng Shui is not just throwing pillows around Sep 18 ellocoart : Don Says What? (El LoCo) Sep 18 Turning it inside out Sep 17 Woody Allen has a favorite font: EF Windsor Elongated or EF Windsor Light… Sep 14 Surprise Sep 13 Secret Weapon Sep 13 “No Surprises” by Radiohead Kalimba Cover (by Nicole He ) Sep 9 The Smoothest Con Man Sep 7 The Cheapest Generation Sep 7 Wolfram-Alpha Personal Analytics for Facebook Sep 7 Advertising's bumpy transition Sep 7 A majestic male lion reveals his ‘inner cub’ as he becomes fixated on a… Sep 7 Movie posters with one letter removed. Sep 6 Poo-capalypse Sep 6 The Debunker: Is There A "Dark Side" Of The Moon? Sep 5 The global debt clock Sep 5 Chrome Time Machine Sep 4 Weekend Reading Aug 31 Mark Twain via Wikiquote Aug 31 Benefits of riding a bike Aug 30 Bounce. Aug 29 Snake Oil? Scientific evidence for health supplements Aug 28 Wasting time at work Aug 28 Spotting Suspicious Reviews Online - NYTimes.com Aug 27 Star Gazing Aug 27 The future according to films Aug 27 Trendy like… Aug 26 Film snob Aug 26 How The Dark Knight Rises Should Have Ended (by HISHEdotcom ) Warning :… Aug 25 Children's book sculptures Aug 24 You know you can breath underwater, don’t you fish? Aug 23 Yes please. Aug 23 Deep Valley of the Mills, Sorrento, Italy . Aug 23 xkcd: Star Ratings Aug 23 53 'Arrested Development' Jokes You Probably Missed Aug 23 Hurricanes Since 1851 . Absoluty incredible. It’s interesting how such… Aug 22 Joker and Robin Aug 22 I shall become a bat . Aug 22 Maybe. Aug 22 Yes. I want it. Aug 22 An Unusual Final Exam Aug 21 Google Analytics In Real Life - Online Checkout . via . Aug 21 I’m confident the new iPhone will have more new features than this, but this… Aug 21 The 20 most-watched TED Talks to date Aug 21 The Great Discontent: Seth Godin Aug 21 crookedindifference : 2001: A Space Odyssey Cinemagraphs Aug 21 Subway Poetry Aug 21 From the J. R. R. Tolkien poem, All that is gold does not glitter . atavus :… Aug 21 Dress for the job you want Aug 21 Taken at Cloud Break at an outer reef in Fiji, a surfer duck dives his board… Aug 21 Stop Dollar Paids Aug 18 Star Wars: 80's High School Movie Aug 17 Raising Successful Children Aug 17 A color wheel designed by Goethe in 1809 Aug 17 Street stone Aug 17 Perseid Meteor through the Milky Way Aug 17 Mars Panorama: Curiosity rover on Martian solar day 2 Aug 17 Four Sisters Recreate Their Childhood Photos Aug 15 [](http://imgur.com/gallery/cEn5W ) Aug 14 And The Most Amazing Internet Stock In The Past Year Is... Aug 14 Wikipedia Redefined Aug 14 oberservationpaper : “Workflow is understanding your job, understanding your… Aug 12 The Stupidity of Computers Aug 11 Cyborg America: inside the strange new world of basement body hackers Aug 11 Summer Storm Spins Over Arctic Aug 11 Eight Glasses of Water a Day? Seriously? Aug 10 Designing the Rio Olympics Logo Aug 9 Hello Mars Aug 9 Before Green Eggs Aug 9 Every 100 Meter Men's Medalist in One Race Aug 9 This is now! Aug 9 The neverending commute Aug 7 Meet me at the bar Aug 7 What are questions? Aug 6 eBooks Gone in 5 Years? Aug 6 via Back To The Future - Blog - Oo-De-Lally :: Yippee! – The Art Blog of… Aug 5 [](http://25.media.tumblr.com/oLS435mPEpfua46bFQUIemLPo1_500.jpg ) Aug 5 Essentialist Explanations Aug 5 The Business of Bond Aug 5 Dora the Explorer live action movie trailer. Aug 4 Unusual Words Rendered in Bold Graphics Aug 4 The Twitter Political Index Aug 4 One week in Aug 3 Crazy Eyes Aug 3 Why Is It Hard to Make Friends Over 30? Aug 3 Understanding Introverts Aug 3 Jim Barksdale - via A VC: Yahoo Is No Longer Dead To Me Aug 2 Divers make funny faces mid-fall. Unfortunately, you don’t notice it on TV,… Aug 2 Alligators All Around Aug 2 Politics and the English Language Aug 1 Life Below 600px Aug 1 P is for Pixar Aug 1 Minimalist Posters about the Major Art Movements, by Outmane Amahou. Jul 31 And then the music stopped Jul 30 Medal Count Jul 30 Cellphones Then And Now Jul 30 xkcd: Home Organization Jul 30 Chesterton on education Jul 30 2012 Olympics: Opening ceremonies pictures Jul 30 What Is Moore's Law? Jul 28 An open Twitter-like ecosystem Jul 27 The Usefulness of Useless Knowledge... Jul 27 Rules for being a good Internet citizen Jul 27 Seth Godin Jul 27 Vik Muniz’s Starry Night, after Van Gogh (Pictures of Magazine 2). via Jul 27 The Olympic Mood Jul 27 Don’t overreact. Jul 26 Good design is invisible Jul 26 How to Kill Time Jul 26 Old Spice Voicemail Generator Jul 26 sigourneyweaver-deactivated2020 : Alfred Hitchcock’s famous movie posters as… Jul 24 Things to do Jul 21 The Intrapreneurs Jul 21 Motherland, A Solo Art Exhibition at CoproGallery by Annie Owens Jul 20 falling leaves Jul 20 Untitled 27620408307 Jul 20 “Two noise makers compete for music supremacy.” via Jul 19 » the art of brief emails :mnmlist Jul 19 Liquid suspension, single capture by Jack Long Jul 19 How Americans spend their time. via The Economist Jul 18 Likecoholic Jul 18 Welcome to Life: the singularity, ruined by lawyers (by enyay ) Jul 18 Superhero Math Jul 17 Sentenc.es Jul 17 I think this just means that people who shop in bookstores to learn about… Jul 17 Reduce Your Level of Insecurity Work Jul 16 A lot of people enjoyed Tim Kreider’s, The ‘Busy’ Trap , but I really… Jul 16 Dream Big. Jul 16 Pay Too Much Jul 14 Sky Monsters by Camille Seaman. via In Focus Jul 14 G.K. Chesterton in the Illustrated London News October 23, 1929 (via… Jul 14 What people really do when ‘working from home’ . Jul 13 There's a lot of planets Jul 13 Only yuppies feel busy Jul 13 John Adams Jul 12 “Write drunk; edit sober.” – Ernest Hemingway Jul 12 70 Years of Batman. Jul 12 The Alphabet of Typography Jul 11 “Holden Caulfield thinks you’re phony.” Jul 11 Wikipedia article traffic statistics Jul 11 Shakespeare’s Hokey Pokey Jul 10 In The City Of Love Jul 10 Some awesome movie semi-stills Jul 10 Millions of People Waiting Jul 9 Death by Degrees Jul 9 Waking up some brain cells Jul 9 Design is how it works Jul 8 Incredible Carved Book Landscape Sculptures by Guy Laramee. Jul 8 Seth Godin, Opportunity cost Jul 8 Next stop: Hatter House Jul 7 Minimalistic Pixar Poster Series Jul 7 Techno life skills Jul 7 Coffee houses were the distracting social media of the 1600s Jul 6 Cover Story Jul 6 Suitty-up, booty-up, billa-be-do-do-da Jul 6 Do people still use pens? ryuuseikuma : For those who constantly forget to… Jul 5 merlin : Wes Anderson - “My Life, My Card” (AmEx Commercial) I will never… Jul 4 Letter to Emily White at NPR All Songs Considered. Jul 3 parislemon : Innovation. (via @JoeTierney ) Jul 2 It’s time to start something. jaymug : Creativity takes no excuses. Jul 1 The choice become clear Jun 30 Explain XKCD Jun 28 Strange Sentences Jun 27 The Hierarchy Of Digital Distractions . Click through for a bigger version. Jun 26 North Atlantic - A tragic short film depicting the conversation between a… Jun 25 The Bean Family Jun 24 The Florida rainy season is back again. That means there’s going to be more… Jun 23 The Dark Side of the Lens. Jun 23 Drunk Texts from Famous Authors Jun 22 I have a good looking kid. (via Gabi's Wall Photos ) Jun 22 Be a little bit of both. (via Cheryl Ann MacDonald- Google+ ) Jun 18 Anton Chekhov, Gooseberries , 1898 May 31 I can bike anywhere . explore-blog : Mapping America’s bike lanes. May 29 I Was a Teenage Minotaur May 28 Should I check email? No, probably not. (via Managing Distraction: How and… May 27 xkcd: Correlation May 26 Confessions of a recovering lifehacker May 25 Cyclicality: Missions and Metrics May 24 Airport security needs to pay attention to some details. May 23 Somewhere Over the Rainbow: from deep inside the Jonathan+Gabi archives Apr 30 Darth Vader and Son – Book Trailer (by ChronicleBooks ) What if Darth Vader… Apr 19 AI is not about replicating human intelligence Apr 18 Truthful Logos Apr 18 Happy Birthday David Apr 17 How to be an explorer of the world via JasonTheodor.com Apr 14 “ If you can’t reduce your argument to a few crisp words and phrases,… Apr 14 What I'm reading Apr 14 1940 vs 2010 Census: Key Comparisons Between the Years Apr 13 Try the Quite Place Project. It’s nice. Apr 13 Robot Love Apr 13 Why Xanax is the Most Popular Anti-Anxiety Drug in America Apr 12 ZOMBIES, RUN! Apr 12 Text From Dog Apr 12 Show this chart to the next person that says the Internet killed reading books Apr 11 Hammerforum.com Apr 11 Stupid games Apr 11 The Book of the Future Apr 10 Baseball Is Life Apr 10 Rear Window Timelapse Apr 10 Bad Opinion Generator Apr 8 Give people time to act honestly Apr 8 The Girl Who Loves to Levitate For the rest of these see Part 1 and Part 2 .… Apr 8 Seeing the world through “The Collective Snapshot” Apr 7 This gives you a good idea of just how many pixels are in the new iPad… Apr 7 The Birth Of Silicon Valley Apr 7 Take The Stairs Apr 6 Could Wikipedia write itself? Apr 6 What does it take to come up with a really great idea? This drawing from… Apr 6 Quantify: Creativity Apr 5 iwdrm : “If you wake up at a different time, in a different place, could you… Apr 5 A map of my home town in watercolor Apr 5 User Experience vs. User Interface Apr 4 Money Pieces . International Currency Sculptures by Kristi Malakoff Apr 4 Arthur C. Clarke Predicts the Internet & PC (by openculturevideo ) In 1974… Apr 4 Type Connection Apr 3 The HTML5 Gendered Advertising Video Remixer Apr 3 LG begins mass production of first flexible, plastic e-ink displays . This… Apr 3 At world’s end: Artists reveal stunning post-apocalyptic images of the… Apr 2 Comic Sans for famous brands Apr 2 Animals as the alphabet Apr 2 Pentametron Apr 1 Newspaper April Fools’ hoaxes Apr 1 The History of April Fools Day (by jeremiahjw ) Apr 1 They’re going to win. (via The Meta Picture ) Mar 31 The Setup -- Jonathan Frei Mar 31 Tangentially related. - Indexed Mar 31 The Coffee Facts by Medness Click any image to see it bigger. Mar 30 I really enjoyed reading the play Exiles last year, and the vintage cover is… Mar 30 Dain Fagerholm: Creature in Cube with Gem (stereographic drawing) Mar 30 Movies as code Mar 29 Wind Map Mar 29 Alberto Seveso shared these stunning photos of ink in water, a due Colori,… Mar 29 Ballet dancers slowed down Mar 28 Mass produced hits Mar 28 Frustro: The Impossible Font Mar 28 Facebook Threatens Legal Action Against Employers Asking for Your Password Mar 27 This Is a Fingerpainting . Needless to say, it was not completed by a… Mar 27 Designer Degrees Mar 27 Everything Don Draper Said Mar 26 How Do We Identify Good Ideas? >> Wired Science Mar 25 Screenshots of Despair Mar 25 Get another brain by learning another language Mar 25 Turn on your brain with metaphors Mar 24 Post PC Mar 24 I’m glad we got the Kindle and iPad instead of this 1933 imagining of a… Mar 24 The girl with the camera and mirror Mar 23 LEGO: The Simpsons via Laughing Squid Mar 23 lonelysandwich . January, 2008. Just so we always remember where it all… Mar 23 Good ideas write themselves Mar 22 I’ll bet it’s more accurate than the nightly news. nevver : The Weatherstone Mar 22 Get some sleep Mar 22 The internet delivers only one medical diagnosis. via Mar 20 Universities will shrink to coffee shops Mar 19 A violin from the inside (via the Behance Network ) Mar 18 The myth of the overnight success Mar 17 New Star Wars Identities Posters Shows What Characters Are Made Of Mar 17 John Gruber on the new iPad Mar 16 Flow Mar 15 Stop Calling it Curation Mar 14 How could we have missed this? The characters from Captain Planet are just… Mar 13 Posterous acquired by Twitter Mar 12 Here’s hoping that they accepted his refusal of his denial Mar 12 10 Tips on Writing from the original Mad Man Mar 11 Cool Geometric Illustrations of Pop Culture Icons by Liam Brazier Mar 11 Justice is blind. (via Matt Frederick - Portraits ) Mar 11 LIFE Magazine's Best Pictures Mar 10 That's Not Your Mommy Anymore: A Zombie Tale Mar 10 Trading clothes with your loved ones Mar 10 What is the Future of Books? Mar 9 Toy Shining Mar 9 Romance authors get a free pass Mar 9 What happened to newspapers? Mar 8 The Ciphers of Social Media Mar 8 Famous explosions, rendered with cauliflowers Mar 8 How parents harm their kid's education Mar 7 The modern Japan Mar 7 Epic Action Photos of Porcelain Figurines Shattering Against the Ground Mar 7 10 Commandments for Con Men Mar 6 Why read books above your 'level' Mar 6 One Way To Distract An Athlete On The Court Mar 6 The psychology of priorities Mar 4 Dogs as Fonts You may also like Cats as Fonts . Mar 4 We are information scavengers. - Indexed Mar 4 When “UP” Meets Star Wars Mar 3 cycnus : Minimalist Pixar Posters Mar 3 Shower Design WIN Mar 3 There's something different about smart people Mar 2 Something Definitely Gets Lost in Transit Mar 2 Free markets tend towards the complex Mar 2 via JasonTheodor.com Mar 1 Gather up the good brains Mar 1 This might be slightly less funny if it were slightly less true. (via DOGHOUSE ) Mar 1 Rules are no substitute for judgement Feb 29 The Changing face of plastic surgery infographic on Flowingdata.com shows… Feb 29 Frank Chimero This is from his brand new website. Feb 29 Gettysburg_Cemetery_Dedication11191863.ppt Feb 29 Highlight from Joseph Conrad's "Victory" Feb 29 Google+ is in trouble. You can have all the “registered users” you want, but… Feb 29 Better than buying links Feb 25 The phases of life are depressing. (via EscaWorks - Phases Of Life ) Feb 25 BoraBora Sunshine Tablets: A sunny day in pill form. (via Vaulot&Dyèvre ) Feb 25 Templates for modern movie posters via Dr. Monster Feb 25 What makes a diamond real? Feb 24 World Press Photo of the Year - 2011. Check out all the 2011 winners from… Feb 24 The smartest people are pointing us to games Feb 24 That would be messy. Check out more Brilliantly Sarcastic Responses To… Feb 23 Solve for X: Neal Stephenson on getting big stuff done (by wesolveforx ).… Feb 23 There’s more of these incredible sculptures on Takanori Aiba’s Flickr… Feb 23 Ayn Rand via Letters of Note , where you can read the full letter with this… Feb 22 Jacob Sutton’s L.E.D. Snowboarder (by tb303meets606 ). Fashion photographer… Feb 22 There's a place to go if you're paranoid Feb 22 Awesome . Flavorwire’s compilations of The 20 Most Beautiful Bookstores in… Feb 21 Breaking an addiction to Equasy or banning it entirely Feb 21 School Kills Creativity - Ken Robinson (by koekskesberg ). There’s also his… Feb 21 via xkcd: Kerning Feb 20 THE COMPOSITES Feb 20 Obviously, I’m not condoning piracy, but it’s clear from this image that… Feb 20 “Cigarettes are like squirrels. They’re not dangerous until you put one in… Feb 19 This is what life was like before Google fixed it. (via Shoebox » Chuck &… Feb 19 Mark Twain in Following the Equator via Brain Pickings Feb 19 David Allen, Productive Living Feb 18 Follow the TV References Feb 18 Marry a happy person. (via Dilbert comic strip for 02/10/2012 from the… Feb 18 Art History Through Sci Fi-Colored Glasses Feb 17 African proverb Feb 17 Wordpharmacy is a concrete poetical work, which playfully equates the… Feb 17 I don’t know if anyone I know will get this. (via ThinkGeek :: ~/ Sweet ~/… Feb 16 Under the Microscope #6 by CambridgeUniversity Cancer cells get attacked by… Feb 16 Countries & Colour by Jerod Gibson This is an ongoing series of geographic… Feb 16 Pick one goal for all your priorities Feb 15 I am… via Flickr Blog . Iamaustin published the photos from this lovely… Feb 15 The Scale of the Universe 2 Feb 15 Age-Maps Feb 14 Why text? Feb 14 Reality TV's many intersections Feb 14 Afghanistan – touch down in flight by Augustin Pictures As each of us has… Feb 13 Self-proclaimed useless features Feb 13 Hacker News for marketers Feb 13 I’ve never paid for cable, but this chart alone should make cutting the cord… Feb 12 There a lot more of these prints by Niege Borges to enjoy , including ones… Feb 12 Anatomical paper craft Feb 12 A Brief History of Computing Platforms (by AsymcoInteractive ) Read more… Feb 11 The constitutions of classic cocktails Feb 11 grantimatter : Rules of engagement. I think I may need to make these a… Feb 11 Superbowl Twitter mentions visualized on Hotspots.io Feb 10 Dress Pant Sweatpants from Betabrand I doubt I could get away with these at… Feb 10 To Know, but Not Understand: David Weinberger on Science and Big Data Feb 10 Everything old is new again Feb 9 Death by brainstorming Feb 8 Processes instead of goals Feb 7 The bottle of wits Feb 6 Thomas Sowell Feb 5 Joseph Conrad, Victory Feb 4 oliphillips : Life is Beautiful by Farhad Moshiri Feb 3 Jason Theodor, M.A.P.S.: The Four Pillars of Creative Job Fulfillment Feb 2 Trying to keep my lunch. Feb 1 “What if…” Movies reimagined for another time & place via Behance. Jan 31 Changing the past Jan 30 Magnus Carlsen, chess master (via Chess News) Jan 29 Thomas Sowell Jan 28 Super high-def image of earth from space Jan 27 The greatest invention Jan 26 Photographers with their best work Jan 25 The public domain needs Mickey Mouse Jan 24 This is my life. Jan 23 What's different about this tech bubble? Jan 17 A degree alone is not enough Jan 17 16th Century social media Jan 17 Five musicians sharing a guitar: Somebody That I Used to Know - Walk off the… Jan 16 Oh, the Places You’ll Go, recited by Burning Man goers (by Tedshots ) Jan 15 These books are alive Jan 15 Quiz yourself. (via 2000s Film Alphabet, Poster That Quizzes Your 2000′s… Jan 15 Fotoshop by Adobé Jan 14 This is not my presentation..I hope Jan 14 The Planetary Chocolates of the Solar System Jan 14 How to nap - Boston.com Jan 11 git - the simple guide Jan 11 Primary Elections Explained by CGPGrey . This video explains many of the… Jan 10 The day the music died Jan 10 Jeff Bezos - from Wired Magazine Jan 10 foxontherun : (via graphics / your dreams ) Jan 9 Shake On It – It’s Not Crazy, It’s Sports – ESPN Commercial (by ESPN ) Jan 9 milkchugger : By recovering lazyholic Jan 9 ollymoss : Star Wars My take on the original Star Wars Trilogy.… Jan 8 Batman, Meet Dr. Seuss via The Adventures of Accordion Guy in the 21st Century Jan 7 Is Life Good? Jan 7 Last post from a writer's writer Jan 7 Has Hollywood Lost it’s Way? via Short of the Week Jan 6 Drip Coffee Jan 4 The Title Design of Saul Bass Jan 3 History of the Modern Calendar Jan 2 Facebook: a wasted platform Jan 2 United State of Pop Jan 2 William Dersiewicz: The Entrepreneurial Generation - NYTimes.com Jan 1 Notes from "The Way to Wealth" Jan 1 Fyodor Dostoyevsky – The Idiot Jan 1 2011 Granpa Shuffelin' Dec 31 What do teachers know when they're not doers? Dec 31 What Are You Doing New Years Eve? Dec 31 Why I Prefer Pro Dec 30 –Viktor E. Frankl, Holocaust survivor, author of Man’s Search for Meaning via Dec 30 City Math Dec 30 JAMES TARANTO, Better Late Than Never - WSJ.com Dec 29 These artifacts are often found outside the city center. - Indexed Dec 29 Design like nobody’s watching [comic] Dec 27 Do This Dec 26 31 Step Financial Tuneup Dec 26 from The Idiot by Fyodor Dostoyevsky Dec 25 As James Joyce said, “In the particular lies the universal.” (via Op-Ed: In… Dec 25 Magic Ink: Information Software and the Graphical Interface Dec 24 Done is best... Dec 24 The Psychology of Social Commerce Dec 23 Branding is easier than it appears (via xkcd: Brand Identity ) Dec 23 [](http://farm7.static.flickr.com/6042/6263689579_1703054e43_o.gif ) Dec 23 Don’t use math. (via Dilbert comic strip for 12/19/2011 from the official… Dec 22 Computer Triage Dec 22 Mud Rooms, Red Letters, and Real Priorities - 43 Folders Dec 22 Left brain / Right brain (via Ads of the World ) Dec 21 2011 Winners of the National Geographic Photo Contest Dec 21 The Future of Science Dec 21 Dolphin Jet Pack Dec 20 GTD Advice Made Easy Dec 20 Seth’s Blog: The extraordinary revolution of media choice Dec 20 Social business planning Dec 19 msg : arig : Albert Einstein - I have no special talents. I am only… Dec 19 Merlin Mann, Cranking - 43 Folders Dec 19 Identifying conflicts in a UI design - (Ryan Singer) Dec 18 Quick 50 Writing Tools [PDF] Dec 18 The Technology of Global Unrest (kk.org) Dec 18 Andrew Hunt, The Pragmatic Programmers Dec 17 The Cult of Done Dec 17 The Supercut Dec 17 Jerry Seinfeld explains the appeal of Facebook, long before the site… Dec 16 James Taranto, from Sexual Harassment Stories . Dec 16 Tool-Makers Dec 16 Commuting is Expensive Dec 15 Easier Is Better Than Better - Smashing Magazine Dec 15 Types of Online Engagement Dec 15 The Personalized Web Dec 14 What do you think about books? Dec 13 Today Dec 5 Untitled 13685143333 Dec 3 21 suggestions for success (via @thecoolhunter ) Dec 1 The Beauty Of A Second Nov 30 G.K. Chesterton in The Club of Queer Trades (via gkchestertonquote ) Nov 20 The Expert Enough Manifesto ( via ) Nov 19 (via xkcd: Citogenesis ) Nov 17 Knowing how to hide your sources. Nov 15 designoclock : Tom Garbor Nov 9 A history of philosophical inquiry. What does it mean? Nov 9 A painfully accurate airplane seating chart. (via Pleated Jeans ) Nov 9 10 fact about you. All were true for me. Nov 5 Harvard Sailing Team - Boys Will Be Girls (by HSTSketchComedy ) Nov 3 via Startupquote It’s not we need new ideas, but we need to stop having old… Nov 3 NeoNews Bio Nov 1 Figure this one out… (via Best statistics question ever ) Oct 30 Robert Frost, “A Time to Talk” - (37signals) Oct 29 Sid’s Fate (via Super Punch ) Oct 29 Always make sure you get the email address right. (via xkcd: The Important… Oct 29 Japan cleans up quick. (via Before and After Photos of 2011 Japan Earthquake… Oct 28 How to Break Down a Door: An Illustrated Guide - The Art of Manliness Oct 28 “It Always Seems Impossible Until It Is Done” via Lifehacker Oct 27 What does it feel like to fly over planet Earth? (by yesterday2221 ) Oct 26 Math Puns (via Pizza – Boing Boing ) Oct 23 G.K. Chesterton in What’s Wrong with the World Oct 23 I’ve posted a few of these images in the past, but here’s a good collection… Oct 23 I’m not an Apple boy (yet) but something like this would be awesome for… Oct 23 Everything Takes Time (by wordboner ) Oct 22 The Architecture of Space Oct 22 Ric Bender (via ricbender ) Oct 22 More Data Was Transmitted Over the Internet in 2010 Than All Previous Years… Oct 22 How to get attention on the internet: Cats, cats, and cats. Oct 8 “Here’s to the Crazy Ones.” Apple - Think Different - Full Version (by… Oct 8 Untitled 11184908858 Oct 8 Comic Sans is not official Sep 29 That’s why you always leave a note" - Woot® Sep 29 FACEBOOK & YOU - Very Demotivational Sep 29 Digital Dead Sea Scrolls Sep 28 Draw a Stickman Sep 28 The Computer Dilemma Dvorak News Blog: General interest observations and… Sep 27 The Giving Tree Movie (1973), narrated by Shel Silverstein (by farpman ).… Sep 20 Cult of Done (by spatulated ) Sep 20 Composition. Strunk, William, Jr. 1918. Elements of Style Sep 19 The worlds biggest employers. (via Employment: Defending jobs - The Economist ) Sep 15 “An essential aspect of creativity is not being afraid to fail.” 50mg :… Sep 14 Phrases We Owe to Shakespeare – via English Muse Becky, a 20-year-old… Sep 13 Ponzi Scheme vs. Social Security - By Veronique de Rugy - The Corner -… Sep 13 Mohandas Karamchand Gandhi - Wikiquote Sep 12 Charlatan, Martyr, Hustler (via Poster - Joey Roth ) Sep 12 Superheros are like the rest of us. azizalbraik : Super Heroes Sep 8 Fast or Slow Sep 8 Understanding 9/11: A Television News Archive Sep 7 Google Gravity Sep 7 Mass in Wartime via New Liturgical Movement Sep 7 terrysdiary : How a bad idea starts: “That looks easy… I could do that.” How… Sep 7 What’s wrong with our universities? by James Piereson - The New Criterion Sep 6 Typewriters live on in India Sep 6 Three Minute Philosophy - John Locke (by CollegeBinary ) Sep 6 Options. (via xkcd: Family Decals ) Sep 6 MoMA Exhibitions Sep 5 100 YEARS / STYLE / EAST LONDON (by WestfieldStratford ) Sep 5 StatusVia Sep 5 Triptychs of Strangers #19, The Sunday Faced Cupholder - London (by… Sep 4 Where Children Sleep Sep 4 Beautiful street art by the elusive UK artist Banksy. Sep 4 the Movie title stills collection Sep 3 The 1% More Savings Calculator Sep 3 Philographics Sep 3 Road trip! American student joins rebels in fight for Qaddafi stronghold. (… Sep 3 What I've Learned Sep 2 The First World Problems (by funnyz ). I suppose life could be worse. Sep 2 Cross pollinating brands Sep 2 The evolution of the web Sep 1 BOWIE’S ‘SPACE ODDITY’ Aug 31 It’s not a Ponzi Scheme if you can’t exit! Aug 31 Steve Jobs - Wikiquote - Interview in WIRED magazine (February 1996) Aug 30 Benjamin Franklin’s proof God loves us. (via design is mine : isn’t it… Aug 25 (via sink me in the ocean - Flickr - Photo Sharing! ) Aug 25 (via A Manly Handshake: An Illustrated Guide - The Art of Manliness ) Aug 25 Bon Iver - Holocene (Official Music Video) (by boniver ) Thanks Mary Claire ! Aug 24 Where Are All the Big Ideas? Aug 24 ohryankelley : DC Earthquake Devastation (via: FamousDC ) Aug 24 remediosthebeauty : Ulric Collette’s photo essay, Portraits génétiques,… Aug 23 Now in 3-D! Designers Lars Marcus Vedeler and Theo Tveterås created a 3-D… Aug 23 glueyourfingers : Included in the preface to Oscar Wilde’s The Picture of… Aug 23 thecalicartel : Imagination Shifts Reality- @ RonnyCartel …(Who’s the artist?) Aug 22 derhoeflicherebell : Dave Perillo - 25 Years of Pixar (variant promo poster… Aug 22 Dad Life (by Slickus26 ) Aug 22 Punchfork - The best new recipes from top food sites Aug 21 colourbomb : “Genius” by Andrew Judd Aug 21 Treating the characters in Winnie the Pooh… nevver : No More Problems in… Aug 21 A very minimalist business card. (via Minimalist Business Card - Minimalissimo ) Aug 20 Chimpanzee bottle feeds tiger cubs at zoo in Bangkok. More here . via the… Aug 20 Awkward Family Photos meet It’s Always Sunny in Philadelphia. (via See a… Aug 20 Excerpts from Thomas Aquinas’s Childhood Journal Aug 19 Lithuanian Mayor Defends Bike Lanes With A Tank via Urban Velo Aug 19 startupquote : Your work is going to fill a large part of your life, and the… Aug 19 Move. Eat. Learn. Aug 18 Six Months of Civil War in Libya Aug 18 Consumers spend less than 3% on Chinese goods Aug 18 Parkour on a bike: Danny Macaskill - Industrial Revolutions HD (by Morning3Run ) Aug 17 Mario Bros. Indie Film Trailer (by pixelspersecond ) Aug 13 Kittywood Studios: Cat Videos Incorporated (by pixelspersecond ) Aug 13 xkcd: TornadoGuard Aug 13 Impressionist Jim Meskimen Does Shakespeare in Celebrity Voices (by… Aug 7 “You are not stuck in traffic. You are traffic. Get a Bike. Break free!”… Aug 5 Social network traffic, with and without Facebook. (via How Google ranks in… Aug 5 The Batman Equation via MAKE Aug 4 startupquote : Creativity is the sudden cessation of stupidity. - Edwin Land Aug 4 What is design? viafrank : Everything you ever needed to know about design,… Aug 4 cepankus : Yay! It starts tomorrow!! Aug 3 The thinker of tender thoughts. (via The best of the rest of the internet -… Aug 3 Mobsters lose suits Aug 3 Why newspapers are dying Aug 2 fromme-toyou : Caught in the rain Hope you have a weekend full of surprising… Aug 2 Goes around and comes around Jul 23 Harry Potter vs. Twilight Jul 23 Find the SPF for you Jul 23 Why there are so many competing standards. (via xkcd: Standards ) Jul 21 Soccer and volleyball are too easy for these athletes. Kung Fu Volleyball or… Jul 19 Pixelated animals. bifanoland : 3/10 in my pixel animal series. The age old… Jul 18 The frame is not big enough to hold the painting . Via Super Punch Jul 18 Live Your Dream manifesto via HOLSTEE . Jul 18 Extreme pointillism Jul 17 STATES UNITED LETTERPRESS by beauchamping on Etsy ) Jul 17 Believe in yourself Jul 17 Synchronized sky diving inside a Prague wind funnel. Just think of the Ok Go… Jul 16 Newspeak (via reddit ) Jul 16 Ninja via Dilbert.com Jul 16 No, economists are not psychic Jul 15 How to deactivate a cat. aka, putting a cat in admin mode. A veterinarian… Jul 15 Grains of sand magnified to 250 times real size via Lost At E Minor: For… Jul 15 Angry Birds Coffee Art, via Foodbeast Jul 14 John Adams Jul 14 “You Can’t Cross a Chasm in Two Small Steps” Jul 14 Previously, on 24 (by le nompourflickr ) Jul 13 The Purpose of Universities Jul 13 Body Hackers Jul 13 Books vs the Internet Jul 12 Hunch vs. Gut Feeling Jul 12 zoomar : This makes me very happy. Especially the wigs. archiemcphee :… Jul 12 This is what happens when Youtube announces a 10 hour video limit. (via… Jul 11 River Shiver - Pomplamoose (by PomplamooseMusic ) Jul 11 The Very, Very Many Varieties of Beer, via Pop Chart Lab Jul 11 “If You Don’t Have Time to Do It Right, When Will You Have Time to Do It… Jul 10 Butterfly Man - The Dark Net (by evangelistjfox ) I saw this video at the… Jul 10 Penguins are bad at logic (via Funny Penguin - Fanpop ) Jul 10 [](http://gusto1.com ) Jul 9 Similarities between the Godfather and Arrested Development Jul 9 The World Map of Useless Stereotypes - via NYTimes.com Jul 9 Harry Potter Comic. This is the whole harry pottery series in comic form.… Jul 8 Feedback Loops Are Changing What People Do Jul 8 Woody Allen as Toy Story’s Woddy ilovedoodle : Woody Allen on Flickr. Doodle… Jul 8 Tumblr Jul 7 “ Leonardo’s rediscovered Salvator Mundi , before restoration.” Possible… Jul 7 The Rocketeer 20th anniversary (by John Banana ) Imagine if Pixar made an… Jul 7 Splitscreen: A Love Story by JW Griffiths , shot on a Nokia N8 Phone. Jul 6 Twitter Whom to follow - Chrome Web Store Jul 6 Org charts at major tech companies: arainert : teradome : Organizational… Jul 6 Seth’s Blog: When is it due? Jul 5 The Office before before it was good Jul 5 Why to join Google+ (via xkcd: Google ) Jul 5 CASSINI MISSION: pro-tip, watch in full screen with headphones and prepare… Jul 4 Claiming clairvoyance. (via Saturday Morning Breakfast Cereal ) Jul 4 The World's Best Commercials, 2010-11 - Adweek Jul 4 Reading Highlights: Meltdown Jul 3 Hidden cameo in Indiana Jones: C-3PO & R2-D2??!? cepankus :… Jul 3 Broccoli House brockdavis : Broccoli House I couldn’t build a tree house for… Jul 3 The first weapon made from code. Stuxnet: Anatomy of a Computer Virus (by… Jul 2 How travel writing becomes literature Jul 2 Hang on Woody! (by nplus1 ) Jul 2 The Easiest Way to Succeed as an Entrepreneur Altucher Confidential Jul 1 This map is drawn using data of the connections of 10 million Facebook… Jul 1 Finding Celopatra Jul 1 Death in the Movies Jun 30 Past Picture Picture in the Present Jun 30 Note to entrepreneurs: Your idea is not special - Entrepreneurial Jun 30 101 Marketing Quotes Jun 29 Heavy sentences by Joseph Epstein Jun 29 Luckiest tennis shot ever. Kim Clijsters LUCKY SHOT French Open (by… Jun 29 Learn to steal like an artist (via How To Steal Like An Artist (And 9 Other… Jun 28 Kinect Hackers: unlocking new possibilities in robotics Jun 28 Geek Alphabet (via ABC by *yllya ) Jun 28 (via Work Smarter and More Easily by “Sharpening Your Axe” ) Jun 27 bestrooftalkever : The zeppelin Hindenburg floats past the Empire State… Jun 27 Diagram of geek culture: it’s a big world out there. (via HBO Programming… Jun 26 Arty Bollocks Generator Jun 26 Comic Sans Criminal - There's help available for people like you! Jun 26 Author Vs. Author Jun 25 Post-Artifact Books and Publishing Jun 25 Zinsser's Relationships Jun 25 Game: Sinuous Jun 24 “Success is not final, failure is not fatal, it is the courage to continue… Jun 24 Sad Vador “An actor dressed as Darth Vader waits for tourists who want to be… Jun 24 Coffee vs. Tea Infographic Jun 23 This up to 1000 years old snow has metamorphosed into highly pressurized… Jun 23 Statue of Soviet US Superheros Jun 23 denverpost : New Dietary Guidelines -The Post’s Mike Keefe, June 12, 2011 Jun 22 Mark Twain Jun 22 Seth’s Blog: The last minute (a case against brinksmanship) Jun 22 Daily *ism: Surrealism Jun 21 How do you get this business card? (via Hello - The Indigo Bunting: Pretty… Jun 21 5 Lessons from IBM Jun 21 DVDLater - Save Theater Movies to your Netflix Queue Jun 21 Reading Highlights: June 5 to June 20 Jun 20 We are not running out of space. (via If the world’s population lived in one… Jun 20 Super Cut: Other actors being Woody Allen. NOTE: This is only funny if you… Jun 20 Daily *ism: Socialism Jun 20 Daily *ism: Humanism Jun 19 Scenes From Underground Jun 19 thetenthamendment : “The powers not delegated to the United States by the… Jun 19 Woody and Buzz Lightyear as reimagined by designer Luis Eduardo Vargas… Jun 18 Daily *ism: Manorialism Jun 18 pulmonaire : still time (by Amy Rice ) Jun 18 [](http://i.imgur.com/AnoXo.png ) Jun 17 Daily *ism: Romanticism Jun 17 zeroing : Banksy Jun 17 60moons : Big Browser Jun 16 How to attract women: according to Disney. Jun 16 Where "Non-profit" colleges hide the money Jun 16 Daily *ism: Modernism Jun 16 Daily *ism: Individualism Jun 15 Lady or not: very true. Jun 15 The 100 greatest non-fiction books Jun 15 Get yours today! HAL 9000 Advertisment (by justinvg ) Jun 15 Book Excerpt: Exposing India’s Blood Farmers - Wired Science - Wired.com Jun 15 29 Ways to Stay Creative Jun 15 Do you remember how good Michael Jordan was? In case you forgot… Michael… Jun 14 Angry Birds Live (by lifeisforsharingDT ) Jun 14 WOMEN IN CHINA: A SOCIAL REVOLUTION - More Intelligent Life Jun 14 James Abbot McNeil’s Whistler’s Mother recreated in balloons by Larry Moss.… Jun 12 BMW Powered Twin-Rotor Hoverbike, Gear Patrol Jun 12 (via Robbie and Bobby - Tattoos are Like Cats ) Jun 12 Newspaper map Jun 11 Big Willie Medley (Will Smith A Capella Multitrack) - Matt Mulholland Cover… Jun 11 70 Million by Hold Your Horses ! (OFFICIAL MUSIC VIDEO) (by logreproduction ) Jun 11 Illustration: Oscar Ramos Orozco (via How to Create a Captivating… Jun 10 How to make a movie that sells. (via The Successful Movie Formula - ) Jun 10 Wine Taxonomy: by label Jun 10 Reading Highlights: May 16 to June 4 Jun 9 New Rules for the New Economy Jun 8 Nighthawks of the Living Dead (by Profound Whatever ) Jun 3 MI6 attacks al-Qaeda in 'Operation Cupcake' - Telegraph Jun 3 (via The Force is Strong with The Muppets at Disney Parks « Disney Parks Blog ) Jun 2 Desiderata (via with heart wide open: things to be desired ) Jun 1 Michael Jackson vs Mr. Bean (by Pascal Blais Animation Studio ) May 30 Weezer - Paranoid Android (by weezer ) May 28 RICE KRISPYHENGE (via hello : brock davis ) May 28 WeatherSpark - Weather Graphs, Maps & More May 26 BBC Nature - In Pictures: Top ten new species discovered this year May 25 Profile portrait done in embosses disposable roasting pans and trays.… May 25 Eddie the Great Gray (by Snyder Art ) May 25 Top Ten Myths About the Brain - Science & Nature - Smithsonian Magazine May 24 Kid casting in Arrested Development: kidcasting : Arrested Development… May 24 “Fifteen uncoupled simple pendulums of monotonically increasing lengths… May 24 (via Chart Showing The Average Life Spans of Animals ) May 23 JELLYFISH LAKE, PALAU (by Sarosh Jacob ) May 23 [](http://www.smashingmagazine.com/wp-content/uploads/2011/04/da-vinci.gif ) May 23 Ronen’s Lifesize Ballerina Music Box (by Ronen V ) May 21 Bikes Make Life Better – Projection Art (by peopleforbikes ) May 21 Scenes from China - Alan Taylor - In Focus - The Atlantic May 21 (via Cross Section Views of Leica Lenses ) May 20 A Quick Tour Of Flippin, Arkansas: Pics, Videos, Links, News May 20 The real chain of command for our nuclear arsenal. (via Chain of Command ) May 19 Swiss “Jetman” flies over Grand Canyon (by swissinfovideos ) May 19 Never confuse education with intelligence. May 19 Possibly the most awesome bookmark every. May 18 Manipulating play pit balls with a huge electro magnate. F5 2011 RE:PLAY… May 18 Click through to see the full sized version. (via Saturday Morning Breakfast… May 18 Arthur C. Clarke: Seth’s Blog: An end of magic May 18 I haven’t seen this one in the store yet, but it’s a wine I’d try. (via… May 16 Cinemassacre’s Top 10 Jackie Chan Fight Scenes (by JamesNintendoNerd ) May 16 How to Shoot a Rifle - The Art of Manliness May 16 Signs of Hope in Alabama's Tornado Wreckage - Alan Taylor - In Focus - The… May 16 Reading Highlights: May 9, 2011 to May 15, 2011 May 16 The original Mt. Rushmore design had the presidents depicted from the waist up. May 15 The Technium: Tech Shopping Rules of Thumb May 15 PEOPLE ARE AWESOME (by Hadoukentheband ) May 15 (via Dogs in the news - The Big Picture - Boston.com ) May 14 Vintage Photographs of Moscow 1909 - a set on Flickr May 14 Minimum Wage’s Discriminatory Effects by Walter E. Williams on Creators.com… May 14 laughingsquid : Human Bicycle May 13 It is truly incredible what your brain does when it sees this collection… May 13 Christopher Hitchens: Unspoken Truths - Culture - Vanity Fair May 13 Frank Sinatra Slang May 12 This is a short animated film about a boy and girl seeing light for the… May 12 Death Cab For Cutie’s “Home Is A Fire,” video by Shepard Fairey and Nicholas… May 12 Gnome of the living dead. Etsy artist dougfx , from Seattle created this… May 12 Tracy Chapman - Fast Car (Boyce Avenue & Kina Grannis acoustic cover) by… May 12 A Hoth Realtor Addresses Some of the Concerns Being Raised Over His Decision… May 11 Angry Birds - Chrome Web Store May 11 Respectful Yo Mama Jokes. May 11 there’s a hole in my heart May 10 teachingliteracy : by amberlawn May 10 lionskeleton : (by Nathan Sawaya ) May 10 Massive LEGO sculptures — creations so big that they cannot go unnoticed …… May 10 Word is Van Gogh loved bacon, but decided paint was a better medium for… May 10 Reading Highlights: May 2, 2011 to May 8, 2011 May 9 Untitled 5261129061 May 6 Where the Wild Jedi’s are. (via Latest doodle - “till Luke said ‘BE STILL!�…… May 6 Amazing force: “Complete destruction of House No. 1, located 3,500 feet from… May 6 This is a great art installation, but would also make for a cool party… May 5 WSJ SafeHouse – Share Confidential Documents May 5 Artist Al Farrow creates sculptures out of ammo and gun parts. The one above… May 5 A black and white forest is colored in vibrant hues under our eyes except… May 5 In honor of Star Wars Day… May the Fourth be with you. (via Jeremy… May 4 Who said that? May 4 merlin : adamisacson : Garr Reynolds reimagines “Star Wars” if General… May 3 The Idiot (on my soon to read list). Apr 22 Shadow Puppets Mar 7 I left my head somewhere Mar 3 Most Liked Pictures of 2009 Picture Gallery on CollegeHumor - Funny… Feb 27 An Update is Available for Your Computer - sticky comics Feb 26 Better than mint (I assume) Feb 25 Photograph of an analog alarm clock - disassembled and neatly arranged. (via… Feb 24 Teddy Roosevelt VS. Bigfoot by ~SharpWriter on deviantART Feb 24 Sign of the times…. « Richard Wiseman’s Blog Feb 21 Eat, Buy, Beauty: via www.kottke.org Feb 3 Dancing at the Weber wedding. (Something I made from some photo booth images.) Jan 20 Fresh Whole Rabbit Jan 20 2010 xkcd: Audiophiles Dec 31 Space Jam Dec 30 Water Sculpture (by Shinichi Maruyama ) Dec 21 Brain Oddities: Spelling is Irrelevant to Comprehension - The Big Picture Dec 13 My father was killed my ninjas. Need money for Karate lessons. (via… Dec 7 Ducklings Vs. Wind Gusts Ducks blown off their feet by the wind (via derbydanx ) Dec 5 I’m on a star wars kick today. Here is a star wars alphabet to teach to the… Dec 4 Not only, but also.: Dr. Seuss does Star Wars Dec 4 Crazy hills of San Francisco (by Håkan Dahlström ) Dec 1 Happy Thanksgiving from Turkzilla! (Boing Boing Flickr Pool) - Boing Boing Nov 25 This outta be good. - Indexed Nov 24 “If you’re not paying for something, you’re not the customer; you’re the… Nov 23 Cat vs. Gator. Who will win in the showdown? (hint: the cat does not get… Nov 15 Diary of a Dog. Diary of a Cat (via www.icanhasinternets.com ) Nov 15 Great literature retitled to boost website traffic... Nov 11 A turducken is a dish consisting of a de-boned chicken stuffed into a… Nov 10 Self-Repair Manifesto - iFixit Nov 9 My home state, Florida, from space (via msnbcmedia.msn.com ) Nov 5 PEOPLE ARE AWESOME (via Hadoukentheband ) Nov 4 Works almost as well, costs a lot less - Statistical Modeling, Causal… Nov 3 At least they didn't blow it up first Oct 27 Boba Fett charged Jabba a hefty sum for that Carbonite encased Han Solo:… Oct 27 lamas playing basketball Photoblog - Monks playing basketball Oct 26 Mama elephant kicks baby elephant. Baby elephant gets some good distance…… Oct 25 How they shot the opening story lines in Starwars (via Make: Online : How… Oct 22 Stowaway Croc Causes Plane to Crash Oct 22 Teens Send Incredible Numbers of Text Messages Each Month Oct 22 22words has a very cool collection of shadow sculptures, sculptural art done… Oct 21 The Economic Argument: via imgs.xkcd.com Oct 20 Andy Warhol on Coca-Cola Oct 19 Medicare Fraud Puts Insurance Profits in Perspective - By Mark Hemingway -… Oct 15 Boomerang kids: 85% of college graduates must move back home - Oct. 14, 2010 Oct 14 AIRPLANE, a melodrama! It’s just not the same without the jokes… Oct 9 Generally, you wouldn’t want to stand that close to a volcano. Most… Oct 8 DaveDrawsComics: The Blog!: Seinfeld SuperHeroes Sep 25 Irish Hand Dancing Sep 24 Ninjabread Men Sep 24 Souped Up: How to Make Instant Ramen into a Gourmet Meal [Hack] Sep 23 RealClearPolitics - Random Thoughts on the Passing Scene Thomas Sowell Sep 23 A Pledge to America - The Fall 2010 GOP Agenda - GOP.gov Sep 23 A Pledge to America - The Fall 2010 GOP Agenda - GOP.gov Sep 23 Only for internet geeks and T.S. Eliot Fans: THE .DOC FILE OF J ALFRED PRUFROCK Sep 22 2010 U.S. Election Ratings - Google Sep 21 Yeondoo Jung Sep 18 < p> (via Hardlyart Design: Limited Edition Cycling Prints ) Sep 18 Just look at this awesome banana shoe. Sep 15 Video games lead to faster decisions that are no less accurate Sep 13 xkcd: Password Reuse Sep 13 Google Maps: From 0 to Instant (v0.2) Sep 13 Shadows kiss in public (via s-ak.buzzfed.com ) Sep 9 Globe Genie - Joe McMichael Sep 7 Highest-Paid Athlete Hailed From Ancient Rome : Discovery News Sep 4 Best anti-theft sign - robotpainter Aug 31 Straightforward Street Art Makes the Case for Cycling - GOOD Blog - GOOD Aug 29 CtrlV CtrlX Ctrl Z - Pic - Gear Aug 29 Do young women have camera activated magnet in their heads? pearlswine:… Aug 26 Me biking to work shouldn’t strike anyone as that odd. The most popular… Aug 25 Jonathan Harris . World Building in a Crazy World . Our Digital Crisis Aug 25 Water Before Meal Means Fewer Calories Consumed: Scientific American Podcast Aug 24 Hemingway Aug 24 Don’t be afraid to explore. via www.mint.com Aug 20 Running on water at the youth Olympics opening ceremony… via i.timeinc.net Aug 19 Ryan Freitas - 35 Lessons in 35 Years Aug 18 Kill or cure? Aug 18 Here’s a map of the world’s population by latitude and longitude. via… Aug 13 “Every fall, I explain to a fresh batch of Ph.D. students what a Ph.D. is.… Aug 10 Wait… What Christopher Nolan Movie am I watching? via img2.timeinc.net Aug 7 “I shoot people and pets." The “Blog” of “Unnecessary” Quotation Marks:… Aug 7 Here’s a beautiful Collection of Fantastical landscape illustration. enjoy…… Aug 7 An amazing collection of closeups of eyes. There is some really amazing… Aug 7 Grow A Wall Aug 6 Pearls Before Swine - August 6, 2010 Aug 6 Maximidia Seminars: Vintage Youtube - Ads of the World Aug 6 Maximidia Seminars: Vintage Skype - Ads of the World Aug 6 Maximidia Seminars: Vintage Facebook - Ads of the World Aug 6 Google Launches Multiple Account Sign-In for Multi-Google Account Holders… Aug 3 Inception ripped off a Scrooge McDuck comic Aug 3 Sunsets Around The World Sunsets from the USA, India, Cambodia, Colombia,… Aug 2 Now that’s a proper LEAD singer! Sculptor carves tiny Elvis on tip of a… Aug 2 This is the weirdest action adventure music video I’ve seen. Jul 29 The World In The Year 3000 - Coolvibe “A stunning painting of a possible… Jul 28 History of The Beatles as told by their hair this isn’t happiness.™ Peter… Jul 28 Millennium Falcon Guitar Creator Travis S. Tells Urlesque His Creative… Jul 21 “Runnin’ Rhino” - Animals, Cute T-shirt by Allan Faustino Jul 20 Seth’s Blog: The management of signals Jul 17 (via Pig prank ) Jul 16 Twitter / MJ: She wants to know what I a … Jul 16 (via orangefrizzante) - Home Sweet Home Jul 15 Look! Crispy, Creamy Avocado Fries Jul 14 Rocket Propelled Chainsaw (via Rocket Propelled Chainsaw [PIC] ) Jul 14 Spanish matador Oliva Soto stares at a bull during a bullfight during the… Jul 14 I’m really glad someone has finally done this. Every time I go to get… Jul 14 Meerkat? Mere Cat? Jul 8 Zhangjiajie National Forest Park, China 2010 (湖南张家界国家森林公园) (via ALL THINGS… Jul 1 This is why I don’t pay for cable (via farm5.static.flickr.com ) Jul 1 Joan Rivers and Twyla Tharp, Organized Artists « Student of Change Jul 1 Microsoft .NET vs Java - trailer [Video] Oh my. I’m not this much of a geek,… Jun 30 Daylight Hours Explorer Jun 30 Most Creative People In Business 2010 - Fast Company Jun 30 Architecture’s Modern Marvels - Culture - Vanity Fair Jun 30 Thanks, Lord, for the gift of my own good company. And thanks, too, for… Jun 30 Hulu Plus Launches: Three Networks, Zero Real-Time Shows - Epicenter - Wired.com Jun 30 Don’t you wish you had thought of this one? And yes, it was a real band,… Jun 30 Ricky - LADY GAGA - TELEPHONE ft. Beyonce’ (Drum Cover) (via RickyFicarelli ) Jun 29 Try Garfield minus Garfield the book. Mar 19 Try Garfield minus Garfield the book. Mar 17 My race is “American” Mar 10 applearts: szymon: real life 404 Error Mar 1 Tales of the Alhambra Feb 26 Real Life Buzz Lightyear Feb 25 Why killer whales should not live at marine parks: a tragic reminder -… Feb 25 Killer whales: Other SeaWorld attacks - Orlando Sentinel Feb 25 Alps Feb 25 http://i.imgur.com/Y6nou.jpg Feb 24 Survival tracks via www.woosk.com Feb 12 During World War II the Army Corps of Engineers needed to hide the Lockheed… Feb 12 Cheetahs play with little Impala - Pic - Gear Feb 12 Möbius Ship by Artist Tim Hawkinson - Design Cove Feb 12 Encyclopedias Are Still Helpful - There, I Fixed It Feb 12 APOD: 2010 February 9 - Night Launch of the Space Shuttle Endeavour Feb 12 How many words should your blog post have? Feb 11 2009 Woody Allen Quote Book: Nov 15 Island seen from space. via earthobservatory.nasa.gov Nov 15 Face painting art - Boing Boing Nov 15 via farm4.static.flickr.com Girl, nose to nose, with a tiger Nov 15 SWINE FLU (H1N1) « GraphJam: Music and Pop Culture in Charts and Graphs. Let… Nov 15 Cool Pics: Best Hand Painting Art Ever Nov 15 LEGOs Bring Historical Figures to (Miniature Toy) Life - WebUrbanist Nov 14 Campo de maÃz (via alba_faura ) Nov 14 The 10 weirdest physics facts, from relativity to quantum physics Nov 14 (via mnmal ) Nov 14 The Paradox of Routine and Freedom Nov 13 Eat Me: The Food and Philosophy of Kenny Shopsin Dounut Seeds Nov 13 A Mona Lisa Created from Motherboard Bits Nov 13 SURPRISE!!! Nov 13 The Myth of Self Reliance Nov 7 'Better' is between where you are now and perfect Oct 30 Can a husband and father be a radical lifestyle designer? Oct 28 Remember Memory Oct 27 Encouragement available Oct 27 Not yet a writer Oct 24 Issues with unfinished business Oct 24 A World of Mind’s Creation Oct 23 100 pushups seems a long long long way away Oct 23 88 Examples of Incredible Aerial Photography Oct 23 A participant in the annual Rubik Cube Hungarian Open Championships solves… Oct 23 Perception Oct 22 Big change can be easy if the change happens over night Oct 21 10 Revealing Infographics about the Web Oct 17 Kramer’s Entrance (via tylercreviston ) Oct 17 The 10 Biggest Misconceptions We Learn In School - Manolith Oct 13 5k Run: Weakness Accomplishes Nothing Oct 13 Storm Trooper: Singing in the Rain Oct 12 Care for the Dead Oct 11 What goes in will come out Oct 10 Fresh Pics: Free-Falling Art Of Li Wei Oct 10 Greg Mankiw's Blog: First-Year Grad Student Wins Nobel Prize in Economics! Oct 10 [](http://donttouchmymoleskine.wordpress.com/2009/10/08/se-liga/ ) Oct 9 The three elements of full employment Oct 9 Oh Shi- [PIC] Oct 9 Dropped by rushmaven. Oct 9 Twitter Talking Separately to Microsoft and Google About Big Data-Mining Deals Oct 9 Unbelievable: “123456” Most Common Hotmail Password Oct 9 Motivational Posters: Winston Churchill Edition (Part I) - The Art of… Oct 8 What’s the Point of Education? Oct 8 teacup-sized pigs Oct 8 Procedure List + Monday Refocus Form Oct 8 Weird Wonders: 15 of the World’s Strangest Animals Oct 8 Today is the day for my run Oct 8 Caring for Aging Parents - Dealing with Aging Parents Oct 8 The art of brief emails - mnmlist.com Oct 8 Rubikcubism on yay!everyday Oct 8 Creative Art in Fly dead body - 15 Pics - Curious, Funny Photos / Pictures… Oct 8 Telescopic Text © Joe Davis 2008 Oct 7 Focus on your Personal Strengths, Not Correcting All the Weaknesses Oct 7 Facebook: Gabriela Frei: How Jonathan Slayed the Alligator Oct 7 Little Soldier Girl “Didn’t Want to Let Go” - NBC Philadelphia Oct 7 Why we remember what we remember Oct 7 New blog design released Oct 7 Favrd. Oct 5 Writing in specifics Oct 4 Idée Labs Oct 4 TweetPsych TweetPsych uses two linguistic analysis algorithms (RID and LIWC)… Oct 4 Federer between the legs shot at US Open Oct 4 family portrait Oct 4 Boy with a tiger. I’m not sure I could get that close. The tiger looks hungary Oct 4 Sesame Street Channels Mad Men Oct 4 Home Sweet Home I need to find some white furniture for my son to color on… Oct 4 Favrd. Oct 4 Star Wars: Uncut I’m so excited for this project to get finished. Such fond… Oct 4 Getting Started Oct 4 Writing in specifics Oct 3 Financial win Oct 1 Learning to run Sep 29 Finally, I didn't snooze 'till seven Sep 28 Unsubscribe Sep 26 Unburdened technology Sep 26 Tools of the trade Sep 26 A Primer on Dream Recall Sep 26 Debt is a Heavy Load Sep 26 Distractions are Good Sep 24 Best Productivity Blog Sep 24 Don't Wait to Start Sep 21 Binary Happiness Sep 19 The Blog...A Few Introductory Notes Sep 18 Learning to Live with the Noise Sep 14 When winning is not enough Sep 11 The importance of symbols Sep 11 Are humans still evolving? Sep 11 More of More or More of Less Sep 9 Controlled Distractions Sep 9 Where is the world going? Aug 29 More Voices Please Aug 29 Caught in the rain Aug 29 Archive Search Tags2012201437signalsabstractadsadvertisingafghanistanaialan tayloralfred hitchcockalligatoralphabetandy baioanimalsanimationapartmentappappleapril foolsarchitecturearrested developmentartartificial intelligenceastronomyatlanticattentionautomationbabybatmanbatman and robinbest of the webbig databig picturebikebirthdayblack and whitebloggingboing boingbookbook coverbrain pickingsbrandingbubblebusinessbusiness insiderbusycalvin and hobbescancercartographycatcatholiccensuschartchesschestertonchildren s bookschristmascinemacinemagraphcityclimatecloudscoffeecollagecolorcomiccommutecomputerscopy rightcreativitycssculturecuriositydaily ismdancedanieldarth vaderdatadata analysisdata visualizationdebtdemographicsdesigndevelopmentdhhdiagramdilbertdisneydistractiondogsdon draperdr seussdrawingdustin curtiseartheasterebookeconomicseconomisteducationefficiencyemailembedengineeringevolutionexerciseextreme sportsfacebookfallfamilyfarmer and farmerfashionfavorite tweetfilmfinancefitnessflickrfloridaflow chartfocusfontfootballfuturegabigabriela freigamegeographygeorge orwellgifgiraffegoalsgooglegoogle plusgoogle readergrammargtdhalloweenhappy birthdayharry potterhealthhistoryhollywoodhomehong konghouse of cardsibmillustrationimageimgurin focusindiewebinfocusinfographicinfrastructureinstagraminstapaperinterface designinternetinterviewinvestingiosios gamesipadiphoneiphone 5james bondjames tarantojamie beckjekylljohn siracusajoseph conradkevin burgkickstarterkidskindlelanguagelaptopletterlifestyle designlinkslionlion kinglistliteraturelogoslolmad maxmanagementmapmarco armentmark twainmarkdownmarketingmarsmashupmathmemediamen s fashionmerlin mannmetaminimalismminimalistmobilemobile web developmentmoneymonument valleymoralitymoviemovie postersmusicmythsnamenasanational geographicnaturenetflixnew yorkernewspapersnflnprnytnytimesolympicson writingopinionordinary time poetryowlpaintingpaper craftparentingparisparodypascal campionpersonal financephilosophyphineas and ferbphotophotographyphotoshopphysicspie chartpinterestpixarpixar artpoetrypoliticspopepope francispopulationportraitposterpowerpointprivacyproductivityprometheuspsychologypublishingquotereadingreading highlightsredditremixrobotsrsssatellitesatiresciencescott adamssculptureselfiesep kamvarseth godinshakespeareshort fictionshowsimplicitysimpsonssingle serving sitesitesketchskillssleepslow motionsmbcsocial mediasocial networksocialismspacespacexspeechsportsspotifystar warssteve jobsstocksstorystylesunsetsupercutsuperherossupermansurfingtechtechnologytedthe guardianthe oatmealtimetime lapsetime managementto-dotoolstostoystrailertraveltumblrtumblr birthdaytvtwittertypefacestypographyuiustwouxvaticanvenn diagramvideovideo gamevintagewarwarfarewatchmenwaterweatherwebweb designwellbeingwes andersonwikipediawild lifewildfireswinewinterwordpressworkwriterswritingwriting stylewriting tipswsjxkcdyear end reviewyogayoutubezombieszoo Categoriesblogcultureeconomicsessayessayshistorylinksnotespersonalphotopodcasttechnologyv1-archivev2-archivev3-archive About BooksThe Fertility DeclineJustified CrusadesThe Loop Turns Inward Editorial The Invisible Engine Editorial design system SpaceX earnings Mainframe history Lepanto Robot vacuum Typography specimen RSS feed